Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

256 – 270 of 1,553,791 results

256

Invitrogen™ PPAR delta Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P35396, Q03181
Isotype	IgG
Concentration	1 mg/mL
Antigen	PPAR delta
Gene Symbols	Ppard
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	FAAR; MGC3931; Nr1c2; NUC1; NUC-1; NUCI; NUCII; nuclear hormone receptor; nuclear hormone receptor 1; Nuclear receptor subfamily 1 group C member 2; OTTHUMP00000016256; OTTHUMP00000016257; peroxisome proliferative activated receptor delta; peroxisome proliferator; peroxisome proliferator activated receptor; peroxisome proliferator activated receptor beta; peroxisome proliferator activated receptor delta; peroxisome proliferator activator receptor beta; peroxisome proliferator activator receptor delta; peroxisome proliferator activator receptor, delta; peroxisome proliferator-activated nuclear receptor beta/delta variant 2; Peroxisome proliferator-activated receptor beta; Peroxisome proliferator-activated receptor delta; PPAR[b]; PPARB; Pparb/d; PPARbeta; PPAR-beta; Ppard; PPARdelta; PPAR-delta; PPARdelta/beta
Gene	Ppard
Product Type	Antibody
Gene ID (Entrez)	19015, 25682, 5467
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues M(1) E Q P Q E E T P E A R E E(14) C of mouse PPAR delta.
Classification	Polyclonal
Primary or Secondary	Primary

257

Invitrogen™ Candida albicans Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Yeast
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunodiffusion,Immunoelectrophoresis,Immunohistochemistry,Immunocytochemistry
Form	Liquid
Isotype	IgG
Concentration	5 mg/mL
Antigen	Candida albicans
Regulatory Status	RUO
Purification Method	IgG fraction
Gene Alias	C. albicans
Product Type	Antibody
Formulation	PBS with 0.1% sodium azide; pH 7.2
Immunogen	Candida albicans, type A.
Classification	Polyclonal
Primary or Secondary	Primary

258

Invitrogen™ ADORA1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P25099, P30542
Isotype	IgG
Concentration	1 mg/mL
Antigen	ADORA1
Gene Symbols	ADORA1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	A1AR; A1-AR; A1R; AA1R; adenosine A1 receptor; adenosine A1 receptor variant 1; adenosine A1 receptor variant 2; adenosine receptor A1; ADO-A1 receptor; ADORA1; AI848715; AR; BB176431; RDC7; Ri
Gene	ADORA1
Product Type	Antibody
Gene ID (Entrez)	134, 29290
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues C(309) Q P K P P I D E D L P E E K A E D(326) of rat Adenosine Receptor A1.
Classification	Polyclonal
Primary or Secondary	Primary

259

Invitrogen™ PCSK1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P63239
Isotype	IgG
Concentration	1 mg/mL
Antigen	PCSK1
Gene Symbols	PCSK1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Att-1; Bdp; BMIQ12; EC 3.4.21.93; Furin homolog; LOW QUALITY PROTEIN: neuroendocrine convertase 1; NEC 1; NEC1; Nec-1; Neuroendocrine convertase 1; PC1; PC3; PCSK1; Phpp-1; Prohormone convertase 1; prohormone convertase 1/3; prohormone convertase 3; propeptide-processing protease; Proprotein convertase 1; proprotein convertase subtilisin/kexin type 1; Protein convertase subtilisin / kexin type I; Protein convertase subtilisin / kexin, type I; SPC3
Gene	PCSK1
Product Type	Antibody
Gene ID (Entrez)	18548
Formulation	PBS with 1 mg/mL BSA and 0.05% sodium azide
Immunogen	Synthetic peptide corresponding to residues S(111) V Q K D S A L D L F N D P M W N(127) of mouse PC1.
Classification	Polyclonal
Primary or Secondary	Primary

260

Invitrogen™ Arylsulfatase B Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P15848, P50429, P50430
Isotype	IgG
Concentration	1 mg/mL
Antigen	Arylsulfatase B
Gene Symbols	ARSB
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110007C02Rik; AI480648; Arsb; Arylsulfatase B; Arylsulfatase B (MPS VI); arylsulfatase B complex; arylsulfatase B regulation; arylsulfatase B structural; arylsulfatase B temporal regulation; As1; As-1; As-1r; As1-r; As-1s; As1-s; As-1t; As1-t; ASB; Asr-1; Ast-1; G4S; MPS6; N-acetylgalactosamine-4-sulfatase
Gene	ARSB
Product Type	Antibody
Gene ID (Entrez)	11881, 25227, 411
Formulation	PBS with 0.02% sodium azide
Immunogen	ARSB antibody for a 16 amino acid peptide near the carboxy terminus of human ARSB. The immunogen is within amino acids 460 - 510 of ARSB.
Classification	Polyclonal
Primary or Secondary	Primary

261

Invitrogen™ AMHR2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	Q16671, Q62893, Q8K592
Isotype	IgG
Concentration	500 μg/mL
Antigen	AMHR2
Gene Symbols	AMHR2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AMH type II receptor; AMHR; Amhr2; Anti-Muellerian hormone type II receptor; anti-Muellerian hormone type-2 receptor; anti-Mullerian hormone receptor type 11 SV1; anti-Mullerian hormone receptor type 2; anti-Mullerian hormone receptor type II; anti-Mullerian hormone receptor, type II; anti-Mullerian hormone type 2 receptor; anti-Mullerian hormone type 2 receptor delta 2; anti-Mullerian hormone type 2 receptor delta 9/10; C14; MIS type II receptor; Misiir; MISR2; MISRII; MRII; Muellerian inhibiting substance type II receptor; Mullerian inhibiting substance type II receptor
Gene	AMHR2
Product Type	Antibody
Gene ID (Entrez)	110542, 269, 29530
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE).
Classification	Polyclonal
Primary or Secondary	Primary

262

Invitrogen™ Chromogranin A Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P10645, P26339
Isotype	IgG
Concentration	0.15 mg/mL
Antigen	Chromogranin A
Gene Symbols	Chga
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AL-11; AL26; Beta-granin; betagranin (N-terminal fragment of chromogranin A); catestatin; CgA; CHGA; ChrA; chromofungin; chromogranin A; chromogranin A (parathyroid secretory protein 1); chromogranin A precursor; chromogranin-A; CTNNB; DKFZp686D02253; EA-92; ER-37; ES-43; FLJ25606; FLJ37923; GE-25; GR-44; GV-19; LF-19; LOW QUALITY PROTEIN: chromogranin-A; MGC105435; Pancreastatin; Parastatin; parathyroid secretory protein 1; p-Glu serpinin precursor; pituitary secretory protein I; Serpinin; Serpinin-RRG; SL21; SP-I; SS-18; Vasostatin I; Vasostatin II; Vasostatin-1; Vasostatin-2; WA-8; WE-14
Gene	Chga
Product Type	Antibody
Gene ID (Entrez)	1113, 12652
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human Chromogranin A. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

263

Invitrogen™ GBX2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P48031, P52951
Isotype	IgG
Concentration	0.41 mg/mL
Antigen	GBX2
Gene Symbols	GBX2
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	D130058E05Rik; gastrulation and brain-specific homeobox protein 2; gastrulation brain homeobox 2; Gbx2; Gbx-2; Homeobox protein GBX-2; LOW QUALITY PROTEIN: homeobox protein GBX-2; MMoxA; Stimulated by retinoic acid gene 7 protein; Stra7
Gene	GBX2
Product Type	Antibody
Gene ID (Entrez)	114500, 14472, 2637
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human GBX2. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

264

Invitrogen™ C/EBP delta Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P49716, Q00322, Q03484
Isotype	IgG
Concentration	0.38 mg/mL
Antigen	C/EBP delta
Gene Symbols	CEBPD
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	C EBP; c/EBP delta; C/EBPd; C/EBPdelta; C/EBP-delta; c/EBP-related protein 3; CCAAT/enhancer binding protein (C/EBP), delta; CCAAT/enhancer binding protein delta; CCAAT/enhancer-binding protein delta; CEBPD; Celf; CRP3; NF-IL6-beta; Nuclear factor NF-IL6-beta; transcription factor CELF
Gene	CEBPD
Product Type	Antibody
Gene ID (Entrez)	1052, 12609, 25695
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Full length human C/EBP delta Recombinant protein.
Classification	Polyclonal
Primary or Secondary	Primary

265

Invitrogen™ SPARC Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P07214, P09486, P16975
Isotype	IgG
Concentration	0.54 mg/mL
Antigen	SPARC
Gene Symbols	SPARC
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Basement membrane protein 40; basement-membrane protein 40; BM40; BM-40; Cysteine rich protein; OI17; ON; Osteonectin; osteonectin precursor; Secreted acidic cystein rich glycoprotein; secreted acidic cysteine rich glycoprotein; Secreted acidic cystein-rich glycoprotein (osteonectin); secreted protein acidic and cysteine rich; secreted protein acidic and rich in cysteine; Secreted protein acidic and rich in cysteine (SPARC); secreted protein, acidic, cysteine-rich (osteonectin); secreted protein, acidic, cysteine-rich [osteonectin]; SPARC
Gene	SPARC
Product Type	Antibody
Gene ID (Entrez)	20692, 24791, 6678
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of human SPARC. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

266

Invitrogen™ TNFR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry (Paraffin)
Form	Lyophilized
Gene Accession No.	P19438, P22934, P25118
Isotype	IgG
Concentration	500 μg/mL
Antigen	TNFR1
Gene Symbols	Tnfrsf1a
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	CD120a; CD120a antigen; FPF; hypothetical protein; metalloproteinase inhibitor 4; MGC19588; MS5; n-smase activation assoc. factor; p55; p55 TNF receptor; p55-R; p60; p62; p63; sCD120a; soluble CD120a; soluble TNFR1; sTNF RI; sTNFR I; sTNFR1; sTNFRI; TBP1; TBPI; TIMP metallopeptidase inhibitor 4; Timp4; TIMP-4; tissue inhibitor of metalloproteinase 4; tissue inhibitor of metalloproteinases 4; TNF receptor alpha chain; TNF receptor superfamily member 1A; TNF-alphaR1; TNF-alpha-R1; TNFalpha-R1; TNFAR; TNFR; TNF-R; TNFR I; TNFR1; TNF-R1; Tnfr-1; TNFR1-d2; Tnfr-2; TNFR55; TNF-R55; TNFR60; TNFRI; TNF-RI; TNF-R-I; TNFR-I; TNFRp55; Tnfrsf1a; tumor necrosis factor binding protein 1; Tumor necrosis factor receptor; tumor necrosis factor receptor 1; tumor necrosis factor receptor 1A isoform beta; tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor superfamily member 1A, membrane form; tumor necrosis factor receptor superfamily, member 1A; tumor necrosis factor receptor type 1; tumor necrosis factor receptor type I; tumor necrosis factor-alpha receptor; Tumor necrosis factor-binding protein 1
Gene	Tnfrsf1a
Product Type	Antibody
Gene ID (Entrez)	21937, 25625, 7132
Formulation	PBS with 4mg trehalose and 0.01mg sodium azide
Immunogen	E.coli-derived human TNF Receptor I recombinant protein (Position: I22-T211).
Classification	Polyclonal
Primary or Secondary	Primary

267

Invitrogen™ ITGB1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P05556
Isotype	IgG
Concentration	1.5 mg/mL
Antigen	ITGB1
Gene Symbols	ITGB1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	4633401G24Rik; AA409975; AA960159; Beta OL; beta oligodendroglia; CD29; CSAT antigen; ENSMUSG00000051907; Fibronectin receptor subunit beta; FNRB; Glycoprotein IIa; Gm9863; gpIIa; integrin beta 1; integrin beta 1 (fibronectin receptor beta); integrin beta 1A precursor; Integrin beta1; integrin beta-1; integrin beta-1 subunit; integrin beta1D; integrin precursor; integrin subunit beta 1; integrin VLA-4 beta subunit; integrin VLA-4 subunit beta; integrin, beta 1; integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12); ITBG1D; ITGB1; JG22 antigen; MDF2; MSK12; RGD-receptor; very late activation protein, beta polypeptide; VLA-4 subunit beta; VLAB; VLA-BETA
Gene	ITGB1
Product Type	Antibody
Gene ID (Entrez)	3688
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the Extracellular domain of human Integrin beta 1/CD29. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

268

Invitrogen™ Somatostatin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	P60041, P61278
Isotype	IgG
Concentration	0.10 mg/mL
Antigen	Somatostatin
Gene Symbols	SST
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Antrin; Growth hormone release-inhibiting factor; Neuronostatin; NST; preprosomatostatin; prepro-somatostatin; SMST; SOM; Somatostatin; somatostatin 28; somatostatin-14; Somatostatin-28; somatotropin release-inhibiting factor; SRIF; SS; SS-14; SS-28; Sst; SST-14
Gene	SST
Product Type	Antibody
Gene ID (Entrez)	20604, 6750
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human SST. Recombinant protein control fragment (Product #RP-92481).
Classification	Polyclonal
Primary or Secondary	Primary

269

Invitrogen™ VAChT Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	O35304, Q62666
Isotype	IgG
Concentration	1.83 mg/mL
Antigen	VAChT
Gene Symbols	SLC18A3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	MGC12716; rVAT; SLC18A3; solute carrier family 18 (vesicular acetylcholine transporter), member 3; solute carrier family 18 (vesicular acetylcholine), member 3; solute carrier family 18 (vesicular monoamine) member 3; solute carrier family 18 (vesicular monoamine), member 3; solute carrier family 18 member 3; solute carrier family 18 member A3; solute carrier family 18, member 3; VAChT; VAT; vesicular acetylcholine transporter
Gene	SLC18A3
Product Type	Antibody
Gene ID (Entrez)	20508, 60422
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the C-terminus region of mouse Vesicular Acetylcholine Transporter. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

270

Invitrogen™ C-Peptide Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	P01308, P01322, P01325
Isotype	IgG
Concentration	1.36 mg/mL
Antigen	C-Peptide
Gene Symbols	INS, Ins1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Cpeptide; IDDM; IDDM1; IDDM2; ILPR; INS; Ins1; Ins-1; Ins2-rs1; insulin; insulin 1; Insulin A chain; Insulin B chain; insulin I; insulin-1; Insulin-1 A chain; Insulin-1 B chain; IRDN; MODY10; preproinsulin; proinsulin
Gene	INS
Product Type	Antibody
Gene ID (Entrez)	16333, 24505, 3630
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Carrier-protein conjugated synthetic peptide encompassing a sequence within the center region of human C-Peptide. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
16
17
18
19
...
103,587
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ PPAR delta Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Candida albicans Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ADORA1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PCSK1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Arylsulfatase B Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ AMHR2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Chromogranin A Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GBX2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ C/EBP delta Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SPARC Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TNFR1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ITGB1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Somatostatin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VAChT Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ C-Peptide Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PPAR delta Polyclonal Antibody

Invitrogen™ Candida albicans Polyclonal Antibody

Invitrogen™ ADORA1 Polyclonal Antibody

Invitrogen™ PCSK1 Polyclonal Antibody

Invitrogen™ Arylsulfatase B Polyclonal Antibody

Invitrogen™ AMHR2 Polyclonal Antibody

Invitrogen™ Chromogranin A Polyclonal Antibody

Invitrogen™ GBX2 Polyclonal Antibody

Invitrogen™ C/EBP delta Polyclonal Antibody

Invitrogen™ SPARC Polyclonal Antibody

Invitrogen™ TNFR1 Polyclonal Antibody

Invitrogen™ ITGB1 Polyclonal Antibody

Invitrogen™ Somatostatin Polyclonal Antibody

Invitrogen™ VAChT Polyclonal Antibody

Invitrogen™ C-Peptide Polyclonal Antibody